DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLK6 and CG7432

DIOPT Version :10

Sequence 1:NP_002765.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:251 Identity:82/251 - (32%)
Similarity:117/251 - (46%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    21 KLVHGGPCDKTSHPYQAALYTSG----HLLCGGVLIHPLWVLTAAHCKKPNLQ---------VFL 72
            ::|.|........|:.||::..|    ...|||.||...::||||||.:.:.|         |.|
  Fly   474 RIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRL 538

Human    73 GKHNL-RQRESSQEQSSVVRAV-IHPDYDAASHDQDIMLLRLARPAKLSELIQPL---------P 126
            |..:| ...|.|...:..|:.| .|..:.......||.:|.|.:|.:.|:.:.|:         |
  Fly   539 GDIDLSTDAEPSDPVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMPP 603

Human   127 LERDCSANTTSCHILGWGKTADGDFPDTIQ-CAYIHLVSREECEHAYPGQITQNMLCAGDEKYGK 190
            .||......|   ::|||.|..|....|.| .|.:.:...|:|:.:|...|.:|.:|||....|.
  Fly   604 KERLPGRRAT---VVGWGTTYYGGKESTSQRQAELPIWRNEDCDRSYFQPINENFICAGYSDGGV 665

Human   191 DSCQGDSGGPLVCGDHLR--------GLVSWGNIPCGSKEKPGVYTNVCRYTNWIQ 238
            |:|||||||||:    :|        |:||:|| .||....|||||.|..|.:||:
  Fly   666 DACQGDSGGPLM----MRYDSHWVQLGVVSFGN-KCGEPGYPGVYTRVTEYLDWIR 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLK6NP_002765.1 Tryp_SPc 23..237 CDD:214473 80/246 (33%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 475..718 CDD:238113 82/250 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.