DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLK6 and CG1299

DIOPT Version :10

Sequence 1:NP_002765.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:250 Identity:82/250 - (32%)
Similarity:122/250 - (48%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    21 KLVHGGPCDKTSHPYQAAL-Y---TSGHLLCGGVLIHPLWVLTAAHCKKPNLQ-VFLGKHNL-RQ 79
            |:|.|....|.:.|:.|.| |   :.....|||.||....|||||||.:.:|| |.||:|:| ..
  Fly   260 KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIRQDLQFVRLGEHDLSTD 324

Human    80 RESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSC-----H 139
            .|:.....::.|.|.||||:..:...|:.:|.|.|..:.:..|.|:.|....:....|.     .
  Fly   325 TETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPF 389

Human   140 ILGWGKTAD-GDFPDTIQCAYIHLVSREECEHAY--------PGQITQNMLCAGDEKYGKDSCQG 195
            :.|||||.: |:....:....|.:...:.|..:|        ..|..:.:||||....|||:|||
  Fly   390 VAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQG 454

Human   196 DSGGPLVCGD--------HLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQ 242
            ||||||:..:        :|.|:||:| |.|.....||||::...:.:||.:.:|
  Fly   455 DSGGPLMLPEPYQGQLRFYLIGVVSYG-IGCARPNVPGVYSSTQYFMDWIIQQVQ 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLK6NP_002765.1 Tryp_SPc 23..237 CDD:214473 78/241 (32%)
CG1299NP_647862.1 CLIP 37..92 CDD:463440
CLIP 164..216 CDD:463440
Tryp_SPc 261..503 CDD:238113 78/242 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.