DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG17234

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:262 Identity:86/262 - (32%)
Similarity:126/262 - (48%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    42 QARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEH----HKEAYEVKLGA 102
            :.||.||......|.|||||:.|.|.||||||:.||..:::|||||..|.    ..:.|:|:.|:
  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88

Human   103 HQLDSYSEDAKVSTLKDI---IPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPN 164
            ...||.      .||.|:   |.|..|..:.:..|||:::||.|:.|:..::||.|...| .:|.
  Fly    89 ALTDSN------GTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTN-PYPR 146

Human   165 GLHCTVTGWG--HVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYV 227
            .: ..|:|||  ::....:.|.|..||.|.:.:.|..:|...        :|     .::|||..
  Fly   147 SI-ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLF--------DP-----SLLCAGTY 197

Human   228 EGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLA-----SSYASWIQSKVTE 287
              |:.||.|||||||....:    |.|:||||       |.|..:.|     ..:..||.:.:..
  Fly   198 --GRTACHGDSGGPLVVNKQ----LVGVVSWG-------RKGCVSSAFFVSVPYFREWILNAIAS 249

Human   288 LQ 289
            :|
  Fly   250 IQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 83/250 (33%)
Tryp_SPc 45..284 CDD:238113 84/252 (33%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 83/250 (33%)
Tryp_SPc 27..243 CDD:238113 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.