DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and alphaTry

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:269 Identity:98/269 - (36%)
Similarity:135/269 - (50%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    23 LLRSGTGAEGAEAPCGVAPQ--ARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAH 85
            ||.:...|.|...|.|:.||  .||.|||:.....:|||:|:...|.|.||||:.|...:::|||
  Fly     7 LLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAH 71

Human    86 CFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYI 150
            |..|. .....:|:.|:....|....||||:.|:   |..|.......|||:::||..::||..|
  Fly    72 CLQSV-SASVLQVRAGSTYWSSGGVVAKVSSFKN---HEGYNANTMVNDIAVIRLSSSLSFSSSI 132

Human   151 RPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETC-NCLYNIDAKPEEP 214
            :.|.|...|.:  ||....|:||| ...|.|...|..||.:.|.::|:..| :..|...::    
  Fly   133 KAISLATYNPA--NGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ---- 190

Human   215 HFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYAS 279
              ::..|:||  ...|||||||||||||   |.| ..|.|:||||..|...|.||||...:...|
  Fly   191 --IRNTMICA--AASGKDACQGDSGGPL---VSG-GVLVGVVSWGYGCAYSNYPGVYADVAVLRS 247

Human   280 WIQSKVTEL 288
            |:.|....:
  Fly   248 WVVSTANSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 88/237 (37%)
Tryp_SPc 45..284 CDD:238113 88/239 (37%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.