DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG9737

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:305 Identity:92/305 - (30%)
Similarity:137/305 - (44%) Gaps:70/305 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    37 CGVAPQARITGGSSAVAGQWPWQVSITY-EGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAY---E 97
            ||.....||.||..|...::||...:.| ...:.|.|:|:.::.:|:||||...|..::..   .
  Fly   142 CGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKH 206

Human    98 VKLGAHQLDSYSEDAKVSTLKDIIPHPSYL--------------------QEGSQ---GDIALLQ 139
            |:||         :..|.|..|.|..|:||                    :|.|.   .|||:::
  Fly   207 VRLG---------EFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIR 262

Human   140 LSRPITFSRYIRPICLPAANASFP----NGLHCTVTGWGHV----APSVSLLTPKPLQQLEVPLI 196
            |..|::|:.::.|||||  |.|.|    .|...:|:|||..    ...:::.:|..| :|.:|.:
  Fly   263 LKHPVSFTHFVMPICLP--NKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKL-KLRIPYV 324

Human   197 SRETCNCL---YNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSC--PVEGLWYLTGIV 256
            |.|.|..:   :.:...|::        :||| .|..||.|.|||||||..  .....|...|:|
  Fly   325 SNENCTKILEGFGVRLGPKQ--------ICAG-GEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVV 380

Human   257 SWG-DACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQ 300
            |:| ..||...:|.|||..:.|..||.|        ||.|.::||
  Fly   381 SYGFTQCGMAGKPAVYTNVAEYTDWIDS--------VVQQRKKSQ 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 82/277 (30%)
Tryp_SPc 45..284 CDD:238113 83/279 (30%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 82/277 (30%)
Tryp_SPc 150..409 CDD:238113 84/287 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.