DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:285 Identity:80/285 - (28%)
Similarity:125/285 - (43%) Gaps:50/285 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    19 LYLGLLRSGTGAEGAEAPC-GVAP------QARITGGSSAVAGQWPWQVSITY--EGVHVCGGSL 74
            |::.|..:...|....||. .:.|      |.|||.|..|..|:.|:.|.:.:  .|...||||:
  Fly     3 LFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSI 67

Human    75 VSEQWVLSAAHCFPSEHHKEAYEVKLGA---------HQLDSYSEDAKVSTLKDIIPHPSYLQEG 130
            :...|||:||||   .:......:..||         |.:.|          .|||.|..|....
  Fly    68 IGNTWVLTAAHC---TNGASGVTINYGASIRTQPQYTHWVGS----------GDIIQHHHYNSGN 119

Human   131 SQGDIALLQLSRPITFSRYIRPICLPAANASFPN--GLHCTVTGWGHVAPSVSLLTPKPLQQLEV 193
            ...||:|::... :.|...:..:.||:.|..:.:  |.....:|||.......|  |..||.::|
  Fly   120 LHNDISLIRTPH-VDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPL--PDWLQSVDV 181

Human   194 PLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSW 258
            .:||:..|:..:::          .::|:|.. .:|||..|.||||||| ...:|. .|.|:.|:
  Fly   182 QIISQSDCSRTWSL----------HDNMICIN-TDGGKSTCGGDSGGPL-VTHDGN-RLVGVTSF 233

Human   259 GDACGARN-RPGVYTLASSYASWIQ 282
            |.|.|.:: .|.|::..:.|..||:
  Fly   234 GSAAGCQSGAPAVFSRVTGYLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 71/250 (28%)
Tryp_SPc 45..284 CDD:238113 72/252 (29%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.