DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and grass

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:280 Identity:91/280 - (32%)
Similarity:125/280 - (44%) Gaps:57/280 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    37 CGVAPQARITGGSSAVAGQWPWQVSITY----EGVHVCGGSLVSEQWVLSAAHCFPSEH--HKEA 95
            ||.....|::.|........||...:.|    |...:|||:::||:::|:||||.   |  ..:.
  Fly   111 CGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCV---HGLQNDL 172

Human    96 YEVKLGAHQLDSYSEDAK--------------VSTLKDIIPHPSYLQEGSQGDIALLQLSRPITF 146
            ||::||.|:: |..||.:              |...|.:| |..|.......|||||:|:|.:.|
  Fly   173 YEIRLGEHRI-STEEDCRQQGRKKKCAPPVVNVGIEKHLI-HEKYDARHIMHDIALLKLNRSVPF 235

Human   147 SRYIRPICLPAANASFPNGLHCT---VTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNID 208
            .::|:|||||..:.........:   |||||......|   ...|.|..|||..|..|:..|.  
  Fly   236 QKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSS---SDVLLQANVPLQPRSACSQAYR-- 295

Human   209 AKPEEPHFVQEDMVCAGYVEGG--KDACQGDSGGPLSCPVEGLWYL---------TGIVSWG-DA 261
                  ..|....:|.|   ||  :|:|:|||||||..|.:   ||         .||||.| ..
  Fly   296 ------RAVPLSQLCVG---GGDLQDSCKGDSGGPLQAPAQ---YLGEYAPKMVEFGIVSQGVVT 348

Human   262 CGARNRPGVYTLASSYASWI 281
            ||..:.||:||....|..||
  Fly   349 CGQISLPGLYTNVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 87/271 (32%)
Tryp_SPc 45..284 CDD:238113 88/272 (32%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 88/270 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.