DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG34129

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:342 Identity:78/342 - (22%)
Similarity:140/342 - (40%) Gaps:66/342 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    15 VAILLYLGLLRSGTGAEGAEAPCGV---APQ-ARITGGSSAVAGQ----WPWQVSITYEGVHVCG 71
            |:.||:..|.:|    :|...|..:   .|: .|:.||..:..|.    |..:: :..:|...||
  Fly    10 VSCLLWTCLPQS----QGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRI-LNGDGNFACG 69

Human    72 GSLVSEQWVLSAAHC-FPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDI 135
            .:..:...|:::|:| :|..:..|...|:..|.........|.:.|::  .|. .::.:....|:
  Fly    70 AAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQ--FPE-KFIYQKLYMDV 131

Human   136 ALLQLSRPI--TFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISR 198
            |:::|..|:  ..:.:|| :|    :......:...|.|||.....|.:.:..| :.:.|.:||.
  Fly   132 AVVRLRDPVRGRLTEFIR-LC----SVKVQPKMQMVVFGWGFDNTEVEIPSSDP-RNVTVTIISI 190

Human   199 ETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACG 263
            :.|.      .|.:.|. :....:||...:..|. |..|.|.||....|    |.|:||:|..|.
  Fly   191 KECR------QKFKSPK-IASTSICARQPKNPKQ-CLYDGGSPLIYGRE----LCGVVSFGSHCI 243

Human   264 ARNRPGVYTLASSYASWIQSKVTELQ-----------PRVVPQTQES-----QPDSNLCGSHLAF 312
            ..:|||:||....    ::..:||.:           .:||.:|::.     :|.|         
  Fly   244 DTSRPGMYTNIRR----VKRFITETEESINAGDVFRSTKVVKETKKPPKKTIKPKS--------- 295

Human   313 SSAPAQGLLRPILFLPL 329
            .....|.|||.::..||
  Fly   296 KPVKIQRLLRTVMVEPL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 57/243 (23%)
Tryp_SPc 45..284 CDD:238113 56/245 (23%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/247 (23%)
Tryp_SPc 55..261 CDD:304450 53/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.