DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG11836

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:258 Identity:96/258 - (37%)
Similarity:134/258 - (51%) Gaps:16/258 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    31 EGAEAPCGVA-PQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKE 94
            :..:..||.: .:.||.||......|:||...|.|:|...|||||:::.:|||||||. .:..|.
  Fly    82 KNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCV-KKLRKS 145

Human    95 AYEVKLGAHQLDSYSEDAKVS-TLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAA 158
            ...|..|.|..:..||...:. .:..:|.|.|:..:....|||||:|.:||:||:.|:|||||..
  Fly   146 KIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRY 210

Human   159 NASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETC-NCLYNIDAKPEEPHFVQEDMV 222
            |.. |.|...||.|||..:....|  |..:.|::||::|...| |..|....       :...|:
  Fly   211 NYD-PAGRIGTVVGWGRTSEGGEL--PSIVNQVKVPIMSITECRNQRYKSTR-------ITSSML 265

Human   223 CAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKV 285
            |||  ....|:|||||||||.......:::.||||||..||....||||:..|.:..||:|.:
  Fly   266 CAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 91/238 (38%)
Tryp_SPc 45..284 CDD:238113 92/240 (38%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 92/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.