DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG16710

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:290 Identity:89/290 - (30%)
Similarity:123/290 - (42%) Gaps:69/290 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    37 CG-VAPQARITGGSSAVAGQWPWQVSITYEG----------VHVCGGSLVSEQWVLSAAHCFPSE 90
            || :.|..||.||......:.||...|.|..          |..|.|||::.::||:||||....
  Fly    97 CGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRIT 161

Human    91 HHKEAYEVKLGAHQLDSYSE------------------DAKVSTLKDIIPHPSYL--QEGSQGDI 135
             ..:...|:||.|.:.|..:                  |..:|     |.|..|:  :|....||
  Fly   162 -GLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLS-----IKHRHYMVFEERPYNDI 220

Human   136 ALLQLSRPITFSRYIRPICLPA----ANASFPNGLH-CTVTGWG--HVAPSVSLLTPKPLQQLEV 193
            |||:|..|:.::..|:|||:..    :|.||.|  | ..:.|||  |.....::|       |:.
  Fly   221 ALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSN--HKLQIAGWGLSHKQGYSNVL-------LQA 276

Human   194 PLISRETCNCLYNIDAKPEEPH--FVQEDMVCAGYVEGGKDACQGDSGGPLSCPV----EGLWYL 252
            .:..|....|..:      ||.  ..:|..:|||.: ||.|.|:|||||||...:    |...||
  Fly   277 YVNGRNADECSLS------EPSLGLDKETHICAGNL-GGNDTCKGDSGGPLMAIMERGDEEFVYL 334

Human   253 TGIVSWG-DACGARNRPGVYTLASSYASWI 281
            .||.|:| ..||  ..|..||..|.:..||
  Fly   335 AGITSYGYSQCG--YGPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 84/280 (30%)
Tryp_SPc 45..284 CDD:238113 85/281 (30%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 84/280 (30%)
Tryp_SPc 106..362 CDD:238113 83/279 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.