DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG7432

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:262 Identity:94/262 - (35%)
Similarity:131/262 - (50%) Gaps:26/262 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    37 CGVAPQA--RITGGSSAVAGQWPWQVSITYEG----VHVCGGSLVSEQWVLSAAHCFPSEHHK-- 93
            ||....:  ||.||..|..|||||..:|...|    ...|||||:..:::|:||||......|  
  Fly   465 CGQQEYSTGRIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPF 529

Human    94 --EAYEVKLGAHQL--DSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPIC 154
              ..:.|:||...|  |:...|.....:|::..|..:.:.|...|||:|.|.:|:..|:|:.|:|
  Fly   530 AARQFTVRLGDIDLSTDAEPSDPVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVC 594

Human   155 LPAANASFPN----GLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPH 215
            ||......|.    |...||.|||.........|.:  :|.|:|:...|.|:..|      .:| 
  Fly   595 LPKGIRMPPKERLPGRRATVVGWGTTYYGGKESTSQ--RQAELPIWRNEDCDRSY------FQP- 650

Human   216 FVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASW 280
             :.|:.:||||.:||.|||||||||||....:..|...|:||:|:.||....|||||..:.|..|
  Fly   651 -INENFICAGYSDGGVDACQGDSGGPLMMRYDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDW 714

Human   281 IQ 282
            |:
  Fly   715 IR 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 90/250 (36%)
Tryp_SPc 45..284 CDD:238113 91/252 (36%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 90/250 (36%)
Tryp_SPc 475..718 CDD:238113 91/252 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.