DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG5255

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:272 Identity:83/272 - (30%)
Similarity:128/272 - (47%) Gaps:23/272 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    17 ILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSI--TYEGVHVCGGSLVSEQW 79
            |||.|.|..|...::....|  ...:.||.||..|.||..|:|:|:  ...|.|.|||:::.|:|
  Fly     4 ILLPLVLFTSSAASQILYPP--QYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERW 66

Human    80 VLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPI 144
            :::|||| .......|:.|..|..  |.:...:|......|:.|.:|.....:.|||||.|:..|
  Fly    67 IITAAHC-TRGRQATAFRVLTGTQ--DLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESI 128

Human   145 TFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDA 209
            .|....:|:.|.  :.:...|....:||||.:  |:....|..||.|||..:..|.|...::...
  Fly   129 VFDNATQPVELD--HEALVPGSRLLLTGWGTL--SLGGDVPARLQSLEVNYVPFEQCRAAHDNST 189

Human   210 KPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLA 274
            :.:..|      ||. :.:.|:.||.|||||||....:    |..:|:||..| |:..|..:...
  Fly   190 RVDIGH------VCT-FNDKGRGACHGDSGGPLVHNGK----LVALVNWGLPC-AKGYPDAHASI 242

Human   275 SSYASWIQSKVT 286
            |.|..:|::.::
  Fly   243 SYYHDFIRTHLS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 75/238 (32%)
Tryp_SPc 45..284 CDD:238113 75/240 (31%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 75/238 (32%)
Tryp_SPc 30..252 CDD:238113 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.