DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG31266

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:250 Identity:83/250 - (33%)
Similarity:112/250 - (44%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    41 PQARITGGSSAVAGQWPWQVSI--TYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAH 103
            ||.|:.||::|..|.|||..||  .| ..|:||..::.|.|||:||.|...........|.....
  Fly    48 PQGRVIGGTTAAEGNWPWIASIQNAY-SYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVD 111

Human   104 QLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHC 168
            ..|.|   |...|:..|..|.::.:.....||||||||..|.|:...:.|.| |.......|...
  Fly   112 WWDLY---APYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITL-ADIDELEEGDKL 172

Human   169 TVTGWGHVAPSVSLLT-PKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYV----E 228
            |..|||   .|.::.| .:.||         |.......:||..|:  ...:|.|..|:|    :
  Fly   173 TFAGWG---SSEAMGTYGRYLQ---------EASGTYLPVDACREK--LQNQDDVDLGHVCVQMD 223

Human   229 GGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQS 283
            .|:.||.||:||||   ::....|.||.:||..|| |..|.||...:.|..||::
  Fly   224 AGQGACHGDTGGPL---IDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 79/243 (33%)
Tryp_SPc 45..284 CDD:238113 80/245 (33%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 79/243 (33%)
Tryp_SPc 52..275 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.