DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and Sb

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:290 Identity:100/290 - (34%)
Similarity:152/290 - (52%) Gaps:34/290 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    10 GQLGAVAILLYLGLLRSGTGAEGAEAPCGV----APQARITGGSSAVAGQWPWQVSIT------Y 64
            |.||.|..:            ..|.:.|||    .|:.||.||.||..|:||||||:.      :
  Fly   517 GALGHVKTI------------SAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGF 569

Human    65 EGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSED---AKVSTLKDIIPHPSY 126
            ...|.|||:|::|.|:.:|.||. .:.......:::|.:......|.   .:....|.:: ||.|
  Fly   570 SSTHRCGGALINENWIATAGHCV-DDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVV-HPKY 632

Human   127 LQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQL 191
            .....:.|:||::|.:|:.|:.::.|||||..: |...|::.||||||.::...:|  |..||::
  Fly   633 SFLTYEYDLALVKLEQPLEFAPHVSPICLPETD-SLLIGMNATVTGWGRLSEGGTL--PSVLQEV 694

Human   192 EVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSC-PVEGLWYLTGI 255
            .||::|.:.|..::....:.|   |:.:..:||||..||:|:|||||||||.. ..:|.::|.||
  Fly   695 SVPIVSNDNCKSMFMRAGRQE---FIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGI 756

Human   256 VSWGDACGARNRPGVYTLASSYASWIQSKV 285
            :|||..|...|.|||.|..|.:..||...|
  Fly   757 ISWGIGCAEANLPGVCTRISKFTPWILEHV 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 88/246 (36%)
Tryp_SPc 45..284 CDD:238113 89/248 (36%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 88/246 (36%)
Tryp_SPc 544..785 CDD:238113 89/248 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3380
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291432at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.