DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG9631

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:264 Identity:75/264 - (28%)
Similarity:125/264 - (47%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    37 CGVAPQARI-TGGSSAVAGQWPWQVSITYEGV----HVCGGSLVSEQWVLSAAHCFPSEHHKEAY 96
            |||...:.: .||.....||:||..:: ||||    :.|..|::|::.|::||||...:...:.:
  Fly   188 CGVEGFSPLQIGGDLVTRGQYPWLAAL-YEGVGTATYKCVVSVISKRTVITAAHCIYGKSASQLW 251

Human    97 EVKLGAHQLDSYSED-AKVSTLKDIIPHPSYLQEGS---QGDIALLQLSRPITFSRYIRPICLPA 157
             |.||.|..:...|: |.:.::..::...:|  ||:   ..|:.||.|:.|:.:::||||:||..
  Fly   252 -VYLGRHDRNENPENGASLVSVTSVLTPSAY--EGNPVPDADVGLLVLTSPMVYTKYIRPLCLWG 313

Human   158 ANASFP--NGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQED 220
            :|...|  .|....|.|||:...:.....||   .:.|.|:.|:.|     :........|:...
  Fly   314 SNMGLPPNEGDTGAVAGWGYDRSAQKTRFPK---TVSVRLVPRDQC-----LKEMKRAEDFITRR 370

Human   221 MVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVS----WGDACGARNRPGVYTLASSYASWI 281
            .||||..| ....|.||||..|.......||:.|:||    .|:.|.. ::..:|...:.:..|:
  Fly   371 TVCAGNSE-SHGPCFGDSGSALIVLRNNRWYVRGVVSLSPRHGEICDL-SKYVIYCDVARHIDWV 433

Human   282 QSKV 285
            :..:
  Fly   434 RQNM 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 71/251 (28%)
Tryp_SPc 45..284 CDD:238113 72/253 (28%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 72/251 (29%)
Tryp_SPc 198..433 CDD:214473 71/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.