DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG8870

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:308 Identity:89/308 - (28%)
Similarity:132/308 - (42%) Gaps:62/308 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    21 LGLLRSGTGAEGA--------EAPCGVAPQARITGGSSAVAGQWPWQVSITYEG--------VHV 69
            :||.|.||.....        ...||.: :.:.|.|......::||...:.|..        |..
  Fly    53 IGLRRCGTNKVCCPKWETYLPHDTCGQS-RRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPK 116

Human    70 CGGSLVSEQWVLSAAHC--FPSEHHKEAYE-VKLGAHQLDSYSEDAKVS------------TLKD 119
            |||||::..:||:||||  :|...:..|.: |:||.|...:..:.|.|:            .:..
  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181

Human   120 IIPHPSYLQEGSQ--GDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSL 182
            ||.|..: ..|.:  .||||::|..|:.::|.|:|||||.|.....:......:||..:...:: 
  Fly   182 IITHEQF-NRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIA- 244

Human   183 LTPKPLQQLEVPLIS----RETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPL- 242
                    .||.|.|    |....|..|.|       |.....:|||.:: |.|...||||||| 
  Fly   245 --------SEVLLRSFIAERHPDVCKSNYD-------FNLGSQICAGGLD-GNDTSPGDSGGPLM 293

Human   243 SCPVEG---LWYLTGIVSWGD-ACGARN-RPGVYTLASSYASWIQSKV 285
            ...:.|   |.|..||:|:|. .|..:. :|..||..|.:..||:||:
  Fly   294 ETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 78/271 (29%)
Tryp_SPc 45..284 CDD:238113 80/273 (29%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 78/264 (30%)
Tryp_SPc 93..337 CDD:214473 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.