DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG17404

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:294 Identity:88/294 - (29%)
Similarity:132/294 - (44%) Gaps:41/294 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    12 LGAVAILLYLGLLRSG--TGAEGAEAPCGVAPQARITGGSSAVAGQW-PWQVSITYE----GVHV 69
            :|....||.:|::..|  .|...:..|.|..|. ||.||:....|:. |:|||:.|.    .:|.
  Fly     1 MGLTEQLLLIGVVALGGVFGRLNSRQPSGYTPH-RIVGGADIPPGEHVPYQVSLQYRTRGGQMHF 64

Human    70 CGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLD------SYSEDAKVSTLKDIIPHPSYLQ 128
            ||||:::...:|:||||...          |.|.::.      ..:|....|.:.....||.| |
  Fly    65 CGGSIIAPNRILTAAHCCQG----------LNASRMSVVAGIRGLNEKGSRSQVLSYSIHPKY-Q 118

Human   129 EGSQGDIALLQLSRPITFSR-YIRPICLPAANASF-PNGLHCTVTGWGHVAPSVSLLTPKP-LQQ 190
            |....|:|:|.:..|:..:. .|..|...:....| ..|:..|:||||     :.|..|.| |..
  Fly   119 ELVTSDLAVLSIKPPLKLNNSTISAIEYRSQGKDFVGGGVPVTLTGWG-----LRLPVPFPFLDN 178

Human   191 LEVP-LISRETCNCLYNIDAKPEEPHFVQEDMVCA-GYVEGGKDACQGDSGGPLSCPVEGLWYLT 253
            :..| ::.|.:.:.:.|.:.:......|.:..:|| |...|   ||.|||||||....:......
  Fly   179 VNYPNVLQRMSYHTISNSECRNAGMESVTDTEICARGPFRG---ACSGDSGGPLVMESKNGLQQV 240

Human   254 GIVSWG-DACGARNRPGVYTLASSYASWI--QSK 284
            ||||:| ..||....|.|||..|:::.||  |:|
  Fly   241 GIVSYGLVVCGLYISPDVYTRVSTFSDWIGNQTK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 75/253 (30%)
Tryp_SPc 45..284 CDD:238113 77/257 (30%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 75/253 (30%)
Tryp_SPc 35..269 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.