DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG16749

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:254 Identity:80/254 - (31%)
Similarity:119/254 - (46%) Gaps:30/254 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    40 APQ-ARITGGSSAVAGQWPWQVSIT-YEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGA 102
            ||| .|:..|:.:...::|:.:|:. ..|.|.||||::|:|:|::||||.......: ..|:.|.
  Fly    24 APQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASD-LSVQYGV 87

Human   103 HQLDSYSEDAKVSTLKDIIPHPSYLQEGS-QGDIALLQLSRPITFSRY-IRPICLPAANASFPN- 164
            .::::...:  |..:|.||.|..|....: ..||:||.:..|..|... :.|:.||....:.|. 
  Fly    88 TKINATGPN--VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQT 150

Human   165 --GLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQED---MVCA 224
              |....:.|||..|....:  ...||::|:.:.|.|.|.          |.|..:.|   .:|.
  Fly   151 DAGGEGVLIGWGLNATGGYI--QSTLQEVELKVYSDEECT----------ERHGGRTDPRYHICG 203

Human   225 GYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWG-DACGARNRPGVYTLASSYASWIQ 282
            |..||||..|.|||||||....:.:    |||||. ..|.....||||...|.|..||:
  Fly   204 GVDEGGKGQCSGDSGGPLIYNGQQV----GIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 75/246 (30%)
Tryp_SPc 45..284 CDD:238113 76/248 (31%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/246 (30%)
Tryp_SPc 30..259 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.