DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG12951

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:279 Identity:81/279 - (29%)
Similarity:131/279 - (46%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    14 AVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSI-TYEGVHVCGGSLVSE 77
            ::::::.|.:...|..|...         :|:..|:.:...::|:.||: :|:|.|.||||::|:
  Fly     8 SLSLIVILAVTTVGQAAPSI---------SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISK 63

Human    78 QWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSY-LQEGSQGDIALLQLS 141
            .:|::|||| .:....:...::.|...:.:...:  |..:|.||.|..: ....:..||:||.:.
  Fly    64 HFVMTAAHC-TNGRPADTLSIQFGVTNISAMGPN--VVGIKKIIQHEDFDPTRQNANDISLLMVE 125

Human   142 RPITFSRY-IRPICLPAANASFPN---GLHCTVTGWG--HVAPSVSLLTPKPLQQLEVPLISRET 200
            .|..|... :.|:.|||...:.|.   |:...:.|||  ....||.    ..||::.:.:.|.|.
  Fly   126 EPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQ----DTLQEVSLKIYSDEE 186

Human   201 CNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWG-DACGA 264
            |...:|....|:. |      :|.|..||||..|.|||||||....:.:    |||||. ..|..
  Fly   187 CTSRHNGQTDPKY-H------ICGGVDEGGKGQCSGDSGGPLIYNGQQV----GIVSWSIKPCTV 240

Human   265 RNRPGVYTLASSYASWIQS 283
            ...||||...|.|..||:|
  Fly   241 APYPGVYCKVSQYVDWIKS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 75/245 (31%)
Tryp_SPc 45..284 CDD:238113 77/248 (31%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/245 (31%)
Tryp_SPc 30..260 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.