DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and MP1

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:298 Identity:97/298 - (32%)
Similarity:138/298 - (46%) Gaps:54/298 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    25 RSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITY------EGVHVCGGSLVSEQWVLSA 83
            ||||........||.....|:.||:.....::||...|.|      :| |.|||||::.::||:|
  Fly   118 RSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKG-HHCGGSLINHRYVLTA 181

Human    84 AHC---FPSEHHKEAYEVKLGAHQLDSYSEDAKVS--------------TLKDIIPHPSYLQEGS 131
            |||   .||:.  |...|:||.... |.:.|..|.              .:::.||||.|  .|:
  Fly   182 AHCVSAIPSDW--ELTGVRLGEWDA-STNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQY--PGN 241

Human   132 Q----GDIALLQLSRPITFSRYIRPICLPAANASFPN---GLHCTVTGWGHVAPSVSLLTPKPLQ 189
            .    .|||||:|...:.:|.:|.|:|||...:...|   |....|.|||....:   .|.....
  Fly   242 SRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETN---FTSNIKL 303

Human   190 QLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGL----- 249
            :.|:..:....||..|....:.     |....:|||.|| |.|:|:|||||||.  :|..     
  Fly   304 KAELDTVPTSECNQRYATQRRT-----VTTKQMCAGGVE-GVDSCRGDSGGPLL--LEDYSNGNS 360

Human   250 -WYLTGIVSWGDA-CGARNRPGVYTLASSYASWIQSKV 285
             :|:.|:||:|.. ||.:..|||||...:|.:||::.|
  Fly   361 NYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 88/273 (32%)
Tryp_SPc 45..284 CDD:238113 89/275 (32%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 88/273 (32%)
Tryp_SPc 138..397 CDD:238113 89/275 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.