DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG10587

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:255 Identity:73/255 - (28%)
Similarity:113/255 - (44%) Gaps:52/255 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    42 QARITGGSSAVAGQ-WPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKL----- 100
            |.|:.||......| ..:.:::.||...||||:|:.:..||:|||||..       .||:     
  Fly    43 QTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLG-------RVKISDWLA 100

Human   101 --GAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRP---------ITFSRYIRPIC 154
              ||.:|:......:|   |::|....:.::....|:|:|:|.:|         |...:.:.|  
  Fly   101 VGGASKLNDRGIQRQV---KEVIKSAEFREDDMNMDVAILRLKKPMKGKSLGQLILCKKQLMP-- 160

Human   155 LPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHF--- 216
                      |....|:||| :..:......|.|:.:.||::.::.|...|.........||   
  Fly   161 ----------GTELRVSGWG-LTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLF 214

Human   217 ----VQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYT 272
                :.:.|.||| |.|.||||..||||||....:    :.||||:|..|.::...||||
  Fly   215 LKVHLTDSMFCAG-VLGKKDACTFDSGGPLVYKNQ----VCGIVSFGIGCASKRYYGVYT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 72/253 (28%)
Tryp_SPc 45..284 CDD:238113 71/252 (28%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 72/253 (28%)
Tryp_SPc 46..280 CDD:238113 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.