DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG18223

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:285 Identity:72/285 - (25%)
Similarity:121/285 - (42%) Gaps:59/285 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    68 HVCGGSLVSEQWVLSAAHCFPSE----HHKEAYEVKLG-AHQLDSYSEDAKVSTLKDIIPHPSYL 127
            |.|||.::|..::|::|||...:    |......|..| .::|.|....:....:|.|.. |...
  Fly    77 HFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFV-PDKF 140

Human   128 QEGSQGDIALLQLSRPITFSR-YIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQL 191
            ...:..:|||:.|::.:.... .:..|.||.|:..  .||:.||.|||.:.....|.:  .:..:
  Fly   141 TVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPE--PGLNYTVLGWGRIFKGGPLAS--DILHI 201

Human   192 EVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKD--ACQGDSGGPLSCPVEGLWYLT- 253
            :|.|:.|:.|.         ::.|..:|:|:|||.:....|  .|.||:|.||      ::..| 
  Fly   202 DVELLPRDICE---------KKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPL------IFNETV 251

Human   254 -GIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPA 317
             |:||:...||::..|.:||....:..||..         :....|:   :.||.|         
  Fly   252 FGVVSYRVGCGSKTLPSIYTNVYMHMDWING---------IMNNNEA---NRLCYS--------- 295

Human   318 QGLLRP-ILFLPLGLALG--LLSPW 339
                 | .||..:|:.:|  :|..|
  Fly   296 -----PNYLFTTIGIIIGNKILKSW 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 59/222 (27%)
Tryp_SPc 45..284 CDD:238113 61/225 (27%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/234 (26%)
Tryp_SPc 60..280 CDD:214473 59/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.