DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG6462

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:252 Identity:81/252 - (32%)
Similarity:126/252 - (50%) Gaps:16/252 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    40 APQARITGGSSAVAGQWPWQVSITYE--GVHV--CGGSLVSEQWVLSAAHCFPSEHHKEAYEVKL 100
            |.:.||.||..|..|.:|:||.:..:  |..:  |||||::.|:||:||||.......:.|....
  Fly    72 AVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGAT 136

Human   101 GAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPA--ANASFP 163
            ....::...|:.:| |.:|.|.:|.||..|...|:||::|.|.:..|..::||.|..  .:.:|.
  Fly   137 VFADVEDSVEELQV-THRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFL 200

Human   164 NGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVE 228
            .|...|::|||::..|....| :.||.|:..:|.:|.|.|.:......:..|...:.       .
  Fly   201 VGKVVTLSGWGYLGDSTDKRT-RLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDG-------S 257

Human   229 GGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGAR-NRPGVYTLASSYASWIQSK 284
            .|:.||.||||||:......:.||.|:.|:|.|.|.. ..|.|||..::|..||:.:
  Fly   258 NGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 78/243 (32%)
Tryp_SPc 45..284 CDD:238113 79/245 (32%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 78/243 (32%)
Tryp_SPc 77..314 CDD:238113 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.