DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and yip7

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:283 Identity:86/283 - (30%)
Similarity:133/283 - (46%) Gaps:35/283 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    15 VAILLYLGLLRSGTGAEGAEAPCGVAPQ---------ARITGGSSAVAGQWPWQVSITYE---GV 67
            |.::|.|.|..:..|.....||  |.|:         .|||.|..|||||:|:||.:::.   |.
  Fly     3 VFVVLVLALASASAGLLPNIAP--VHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65

Human    68 HVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQ 132
            ..||||::..:|||:||||.........|   .|| .:.:..|..:|.:......|.|||....:
  Fly    66 WWCGGSIIGNEWVLTAAHCTDGAASVTIY---YGA-TVRTSPEFTQVVSSSKFRQHESYLALTIR 126

Human   133 GDIALLQLSRPITFSRYIRPICLPAANASFP--NGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPL 195
            .||:|:|.| .::||..:..|.|||.:.|:.  .|.....:|||..:...:.:: :.||.:::.:
  Fly   127 NDISLIQTS-SVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVS-RDLQYVDLTI 189

Human   196 ISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGD 260
            ||...|...:.       ...|...::|.. .......|||||||||:  ::|:  |.|..|:|.
  Fly   190 ISNSKCQETFG-------SLIVTSRVLCVD-TTNKASTCQGDSGGPLA--LDGV--LIGATSFGS 242

Human   261 ACGARN-RPGVYTLASSYASWIQ 282
            |.|..: .|..:|..:.|..||:
  Fly   243 ADGCESGAPAAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 75/242 (31%)
Tryp_SPc 45..284 CDD:238113 76/244 (31%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 75/242 (31%)
Tryp_SPc 40..267 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.