DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG13430

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:280 Identity:94/280 - (33%)
Similarity:135/280 - (48%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    15 VAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQW 79
            :|:.|:|      .....|:....|....||.||.......:|.|||:.....|.|||:::|...
  Fly     8 LAVALWL------ICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNI 66

Human    80 VLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQ-EGSQGDIALLQLSRP 143
            :|:||||.......:.|.::.|:   ..:::......:|.|||||.:.. .....|||::||.:|
  Fly    67 ILTAAHCVLEYSKPQYYVIRAGS---SDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQP 128

Human   144 ITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTP-KPLQQLEVPLISRETCNCLYNI 207
            :.:|:.||||.|..:...........|:|||  :.|:|.:.| |.|:...|.|  |:...|..| 
  Fly   129 LVYSQDIRPISLATSKDIIMPTAQLFVSGWG--STSISQMQPEKRLRYTVVHL--RDQNQCARN- 188

Human   208 DAKPEEPHF----VQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRP 268
                   :|    |...|.|||...||:|:|||||||||...::|...|.||||||..|.....|
  Fly   189 -------YFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFP 246

Human   269 GVYTLASSYASWIQSKVTEL 288
            |:||..|:|..||...:.||
  Fly   247 GIYTKVSAYDDWIAQTIEEL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 85/242 (35%)
Tryp_SPc 45..284 CDD:238113 86/244 (35%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 85/242 (35%)
Tryp_SPc 32..262 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.