DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG3700

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:279 Identity:85/279 - (30%)
Similarity:127/279 - (45%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    45 ITGGSSAVAGQWPWQVSITYEGVH-----------VCGGSLVSEQWVLSAAHCFPSEHHK----- 93
            |.||:.|...::|:...|   |.|           .||||:|..::||:||||..::..|     
  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163

Human    94 -----EAYEVKLGAHQLDSYSEDAKVSTLK--DIIPHPSY----LQEGSQGDIALLQLSRPITFS 147
                 ..:.|:||....:|.::||.|...:  :.:.||.|    .::|.:.||||::|.|...|:
  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228

Human   148 RYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPL--ISRETC--NCLYNID 208
            .::..:|||..:.:  :....|..|||..|..|     |....|:|.|  .|.|.|  ...::||
  Fly   229 DHVAAVCLPPDSGN--DVQQVTAAGWGFTADGV-----KSSHLLKVNLQRFSDEVCQKRLRFSID 286

Human   209 AKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPL-------SCPVEGLWYLTGIVSWGDACGARN 266
            .:.:         .|||.:....|.|.||||||:       .|    |..:.||||:|..||::.
  Fly   287 TRTQ---------FCAGSMSSQADTCNGDSGGPIFVQHPLYPC----LKQVIGIVSYGLVCGSQG 338

Human   267 RPGVYTLASSYASWIQSKV 285
            .|.|||....|..||:|.|
  Fly   339 LPSVYTKVHLYTDWIESIV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 81/273 (30%)
Tryp_SPc 45..284 CDD:238113 83/276 (30%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/276 (30%)
Tryp_SPc 102..353 CDD:214473 81/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.