DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and Jon44E

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:127/282 - (45%) Gaps:60/282 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    33 AEAPCGVAP------------------QARITGGSSAVAGQWPWQVSITY-EGVHVCGGSLVSEQ 78
            |.|..||.|                  :.|||.|..|..|:.|:.|.::: :|.:.||||::...
  Fly    11 AVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHT 75

Human    79 WVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVS---TLKDIIPHPSYLQEGSQGDIALLQL 140
            |||:||||..|.:|...|   .||    |:..:|:.:   :..|:|.||.: .:....||||:::
  Fly    76 WVLTAAHCTNSANHVLIY---FGA----SFRHEAQYTHWVSRSDMIQHPDW-NDFLNNDIALIRI 132

Human   141 SRPITFSRYIRPICLPAANASFP--NGLHCTVTGWGHVAPSVSLLTPKP------LQQLEVPLIS 197
            .. :.|...:..:.||:.|..:.  :|.....:|||        ||...      |..::|.:|.
  Fly   133 PH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWG--------LTDNNSGMSNYLNCVDVQIID 188

Human   198 RETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSW--GD 260
            ...|...|.       .:::.::.:|.. .:|||.:|.|||||||......  .:.||||:  |:
  Fly   189 NNDCRNYYG-------SNYITDNTICIN-TDGGKSSCSGDSGGPLVLHDNN--RIVGIVSFGSGE 243

Human   261 ACGARNRPGVYTLASSYASWIQ 282
            .|.| .||..:|..:.|..||:
  Fly   244 GCTA-GRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 73/250 (29%)
Tryp_SPc 45..284 CDD:238113 74/252 (29%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 73/250 (29%)
Tryp_SPc 41..266 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.