DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG30371

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:309 Identity:88/309 - (28%)
Similarity:137/309 - (44%) Gaps:51/309 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     8 GPGQLGAVAILLYLGLLRSGTGAEGA-----------EAPCGVAPQARITGGSSAVAGQWPWQVS 61
            |.|.|...::...|......||.:|.           ...||.:...||..|..|.|.::|...:
  Fly   102 GSGTLSRESLFTELVFAYISTGTKGGSFKCTLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAA 166

Human    62 ---ITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVK--------LGAHQL--DSYSEDAK 113
               :|......|||::|:.:::|:||||.        |:|.        :|.:.|  .|.|...:
  Fly   167 LKDVTKNQASFCGGTIVAHRYILTAAHCI--------YQVSRATNIVAIVGTNDLGNPSSSRYYQ 223

Human   114 VSTLKDIIPHPSYLQEGS-QGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCT-VTGWGHV 176
            ...::.:|||..|:.:.. ..|||:|..:..|.:||.:.|||||....|.|...... |.|:|.|
  Fly   224 QYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGYGTV 288

Human   177 ---APSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCA-GYVEGGKDACQGD 237
               .|     |...||::.:.:::.:.|...||..|.      :....:|. .|...|:|:||.|
  Fly   289 FFAGP-----TSTSLQKINLNVVTNQDCQTEYNNVAT------IYTGQMCTYDYSGTGRDSCQFD 342

Human   238 SGGPLSCPVEGLWYLTGIVSWGDACGARNRP-GVYTLASSYASWIQSKV 285
            ||||:... :...:|.||:|:|.:|.....| ||.|..:||.|||:.|:
  Fly   343 SGGPVILR-KSRQFLVGIISYGKSCAESQYPMGVNTRITSYISWIRQKI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 76/256 (30%)
Tryp_SPc 45..284 CDD:238113 77/258 (30%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 76/256 (30%)
Tryp_SPc 150..389 CDD:238113 77/258 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.