DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG17572

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:296 Identity:88/296 - (29%)
Similarity:135/296 - (45%) Gaps:34/296 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    15 VAILLYLGLLRSGTGAEGAEAPCGVAPQARI----TGGSSAV-------AGQWPWQVSITYEGVH 68
            ||...|.|......|....|.|....|.:.:    ..|.|.|       .|.:|:...|.::.|:
  Fly    88 VARSCYYGDKSLYCGGSSEELPYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVN 152

Human    69 V------CGGSLVSEQWVLSAAHC--FPSEHHKEAYEVKLGAHQLDSYSEDAKVS---------T 116
            .      |.|::::.:.:|:||||  ..::.|:.: .|::|.:...|..:.|...         .
  Fly   153 TGAFAYPCAGAVIARRVILTAAHCALAKADGHRLS-SVRVGEYDTSSDPDCANTGFCAPRSVNHA 216

Human   117 LKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVS 181
            :..:|.||.|.|.....|||||.|..|:.:|...:||||....|:...|...|:.|||.::.| |
  Fly   217 ISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTS-S 280

Human   182 LLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPV 246
            :..|: :..|:|||.|.:.|...|......|.|:.::...:|||  ..|||.|||..|.||....
  Fly   281 VRQPE-MSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAG--GEGKDVCQGFGGAPLFIQE 342

Human   247 EGLWYLTGIVSWG-DACGARNRPGVYTLASSYASWI 281
            .|::...||:|:| |.||....|.|||..:.::.||
  Fly   343 NGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 78/265 (29%)
Tryp_SPc 45..284 CDD:238113 80/266 (30%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 77/246 (31%)
Tryp_SPc 138..378 CDD:214473 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12550
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.