DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG4793

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:365 Identity:97/365 - (26%)
Similarity:155/365 - (42%) Gaps:76/365 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    17 ILLYLGLLRSGTGAEGAEAPCGVAPQARI-----------------------------TGGSSAV 52
            |:.:.||.....|.|..:..|   |:..|                             .....|.
  Fly    45 IIDFRGLNNGNQGCESGQTCC---PKTEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQ 106

Human    53 AGQWPWQVSI--TYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYE----VKLGAHQLDSYSED 111
            .|:.||.|::  :...:.:.||||::...||::     |....|..|    |:.|....:|.:|:
  Fly   107 KGELPWMVALLDSRSRLPLGGGSLITRDVVLTS-----STKTLEVPEKYLIVRAGEWDFESITEE 166

Human   112 A--KVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLH--CTVTG 172
            .  :...::.|:.|.:...|....:.|||.|:||:....:|..||||..|.:|   :|  |.|:|
  Fly   167 RAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNF---IHNRCIVSG 228

Human   173 WG-HVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPH----FVQEDMVCAGYVEGGKD 232
            || ..|...|.:  ..|:::|:||:.|..|      ..|.:.|:    .:...::||| .|.|||
  Fly   229 WGKKTALDNSYM--NILKKIELPLVDRSVC------QTKLQGPYGKDFILDNSLICAG-GEPGKD 284

Human   233 ACQGDSGGPLSCPVE---GLWYLTGIVSWGDACGARNRPGVYTLASSYASW----IQSKVTELQP 290
            .|:||.|.||:||::   ..:.|.|||::|..||. ..|..||..|...||    ||::.....|
  Fly   285 TCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGG-PLPAAYTDVSQIRSWIDNCIQAEAVHYSP 348

Human   291 RVVPQTQESQP-DSNLCGSHLAFSS---APAQGLLRPILF 326
            ::....|...| |..:....|...:   :|.||.|..:::
  Fly   349 QLGNVGQSPAPLDRYIPNIGLETQNEVHSPVQGSLHNVVY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 79/287 (28%)
Tryp_SPc 45..284 CDD:238113 81/289 (28%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 78/249 (31%)
Tryp_SPc 105..335 CDD:214473 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.