DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and psh

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:290 Identity:87/290 - (30%)
Similarity:140/290 - (48%) Gaps:47/290 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    27 GTGAEGAEAPC-----------GVAPQARITGGSSAVAGQWPWQVS---ITYEGVHVCGGSLVSE 77
            |:|...|.|.|           |......|.||.....|.:|...:   ||:.....|||||::.
  Fly   115 GSGDRPAVAACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIAS 179

Human    78 QWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQ-GDIALLQLS 141
            ::||:||||..::.:..|: |:|||..:::.....:...::.:..||.|:  |:: .|||:|:|.
  Fly   180 RFVLTAAHCVNTDANTPAF-VRLGAVNIENPDHSYQDIVIRSVKIHPQYV--GNKYNDIAILELE 241

Human   142 RPITFSRYIRPICL------PAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRET 200
            |.:..:..|||.||      |.:|:.|      .|.||| |....:....|.|.:..:.|:..:.
  Fly   242 RDVVETDNIRPACLHTDATDPPSNSKF------FVAGWG-VLNVTTRARSKILLRAGLELVPLDQ 299

Human   201 CNCLYNIDAKPEEPHFVQ-------EDMVCAGYVEGGKDACQGDSGGPLSCPV---EGLWYLTGI 255
            ||..|     .|:|..::       :.::||...:...|||:|||||||...:   :|::.:.|:
  Fly   300 CNISY-----AEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGV 359

Human   256 VSWGDACGARNRPGVYTLASSYASWIQSKV 285
            :|.|..| |...||:||..|||..:|:..|
  Fly   360 ISSGFGC-ATVTPGLYTRVSSYLDFIEGIV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 79/256 (31%)
Tryp_SPc 45..284 CDD:238113 80/258 (31%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 79/256 (31%)
Tryp_SPc 144..387 CDD:238113 80/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.