DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG9672

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:282 Identity:79/282 - (28%)
Similarity:126/282 - (44%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    17 ILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVL 81
            :.|.:||:....|...|:      ||.||.||..||.||.|:|.:::..|.:.||..::.:::.|
  Fly     3 LTLTIGLILVAAGVLEAQ------PQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYAL 61

Human    82 SAAHCFPSEHHKEAYEVKLGA---HQLDSYSEDAKVSTLKDIIPHPSY--LQEGSQGDIALLQLS 141
            :|..|..|:.....:...|.|   ..:|.|  :.|...:::|..:|:|  |:.|    ||||:|.
  Fly    62 TALSCVCSDGKDTPWAAVLFAVTVGSVDLY--NGKQIRVEEITINPNYSTLKTG----IALLRLQ 120

Human   142 RPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPS-VSLLTPKPLQQLEVPLISRETCNCLY 205
            ..||||..:..|  |.:....|.|....|:|||....| |::.....:...|| :..||   |..
  Fly   121 EEITFSETVNAI--PLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEV-MAPRE---CAL 179

Human   206 NIDAKPEEPHFVQEDMVCAGYVEGGKDA-CQGDSGGPLSCPVEGLWYLTGIVSWG----DACGAR 265
               |..:|.....:.::|.|:  |.:.. |.||.|||..       |...:|..|    ..||..
  Fly   180 ---ANRDELLVADDQVLCLGH--GRRQGICSGDIGGPAV-------YQGQLVGLGAQILGECGGM 232

Human   266 NRPGVYTLASSYASWIQSKVTE 287
            ......::|::| .|||.::.:
  Fly   233 LPERFISIAANY-DWIQQQLQQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 69/247 (28%)
Tryp_SPc 45..284 CDD:238113 71/249 (29%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 69/247 (28%)
Tryp_SPc 25..250 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.