DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and gd

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:289 Identity:75/289 - (25%)
Similarity:111/289 - (38%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    50 SAVAGQWPWQVSITYEGV----HVCGGSLVSEQWVLSAAHCFP---SEHHKEAYEVKLGAHQLDS 107
            |...|.|||..:|....:    ..|||||||.:.|:|:||||.   ..:......|.||.|.|.:
  Fly   256 SITRGSWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKN 320

Human   108 YSEDAKVSTLKD-IIPHPSYLQEGS--QGDIALLQLSRPITFSRYIRPICL--PAANASFPNGLH 167
            ::|:..::...| |..||.:..:.|  ..|||::.|...:.|:.:|||.||  .::...:..|..
  Fly   321 WNEEGSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPACLWSGSSKTEYIVGER 385

Human   168 CTVTGW------------------GHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEP 214
            ..|.||                  |..:...|  .||   .::.|::....|   :..:|     
  Fly   386 GIVIGWSFDRTNRTRDQKLSSELPGKKSTDAS--APK---VVKAPIVGNAEC---FRANA----- 437

Human   215 HF---VQEDMVCAGYVEGGKDACQ-------GDSGGPLSCPVEGLWYLTGIVSWG-------DA- 261
            ||   ......|||.....:|..|       |.||..|.......|.|.|.||..       || 
  Fly   438 HFRSLSSNRTFCAGIQAEERDTHQSGASIYTGISGAGLFIRRNNRWMLRGTVSAALPAVETPDAE 502

Human   262 -----CGARNRPGVYTLASSYASWIQSKV 285
                 | .:|:..:|...:.:..||.:.|
  Fly   503 SSHKLC-CKNQYIIYADVAKFLDWITAFV 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 72/283 (25%)
Tryp_SPc 45..284 CDD:238113 74/286 (26%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 71/282 (25%)
Tryp_SPc 258..526 CDD:214473 71/281 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.