DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG32808

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:316 Identity:95/316 - (30%)
Similarity:145/316 - (45%) Gaps:45/316 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    12 LGAVAILLYLGLLRSGT----GAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSI--TYEGVHVC 70
            :..:|.|..|.|..:.|    ||.|.:        .:|..|::|..|::|:.||:  ...|.|.|
  Fly     1 MAVMAWLARLALFYTATFLLAGASGED--------GKIVNGTTAGPGEFPFVVSLRRAKSGRHSC 57

Human    71 GGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQ-GD 134
            |.:|::..|||:||||.... ..|..:::.|:..|...|  ::|:.:..|..||.|..|... .|
  Fly    58 GATLLNPYWVLTAAHCVRGS-SPEQLDLQYGSQMLARNS--SQVARVAAIFVHPGYEPEDKYVND 119

Human   135 IALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRE 199
            ||||||::.:..|::::|:.||......|......:.|||  ..:...:..:.||::::.:.|..
  Fly   120 IALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWG--LNATGGVVQQHLQKVKLQVFSDT 182

Human   200 TCNCLYNIDAKPEEPH--FVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWG-DA 261
            .|:          |.|  ::.:..:|||..||||..|.|||||||.  :.|.....|||||. ..
  Fly   183 ECS----------ERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLL--LIGSDTQVGIVSWSIKP 235

Human   262 CGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPA 317
            |.....|||:|..|:|..||...|....|          |.|...|..:...|.|:
  Fly   236 CARPPFPGVFTEVSAYVDWIVETVNSYSP----------PSSLWVGQLIVGRSPPS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 78/242 (32%)
Tryp_SPc 45..284 CDD:238113 80/244 (33%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 78/242 (32%)
Tryp_SPc 30..258 CDD:238113 80/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.