DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG32755

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:333 Identity:108/333 - (32%)
Similarity:152/333 - (45%) Gaps:48/333 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    17 ILLYLGLLRSGTGAEGAEA-PCGVAPQARITGGSSAVAGQWPWQVSITYEGV--------HVCGG 72
            :..:.|:.:|..|...|.| |..:.|  :|.||.:....|.|:|||:....:        |||||
  Fly    11 VATHSGITQSQIGQPTATASPFVILP--KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGG 73

Human    73 SLVSEQWVLSAAHCFPSE-------HHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEG 130
            :::|::.|.|||||:...       ...|.|.|..|:..:|......:...::.|:.|..|....
  Fly    74 AVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGST 138

Human   131 SQGDIALLQLSRPITF-SRYIRPICLPAANASFPNGLHCTVTGWGHVA---PSVSLLTPKPLQQL 191
            .:.|||||.|:..|.: |..:|.|  |.|..:...|..|.:.|||.|.   .|.|      |||.
  Fly   139 LENDIALLFLNGFIPWESPGVRAI--PLAIKAPEEGTTCLIHGWGKVTMKEKSAS------LQQA 195

Human   192 EVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIV 256
            .||::::|.|..:|.:.|          ..:|||:::||.|||||||||||.|  :|  .|.||:
  Fly   196 PVPILNKELCQVIYKLPA----------SQMCAGFLQGGIDACQGDSGGPLIC--DG--RLAGII 246

Human   257 SWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLL 321
            |||..|.....|||||..|.:..||:.....|......|.    |..||.......||....|:|
  Fly   247 SWGVGCADPGYPGVYTNVSHFLKWIRRANASLDYSEYRQI----PPLNLASRRSVSSSCLGIGVL 307

Human   322 RPILFLPL 329
            ...:.|.|
  Fly   308 ALAMSLRL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 88/255 (35%)
Tryp_SPc 45..284 CDD:238113 90/257 (35%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/255 (35%)
Tryp_SPc 38..273 CDD:238113 90/256 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.