DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG14780

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:320 Identity:96/320 - (30%)
Similarity:128/320 - (40%) Gaps:68/320 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    42 QARITGGSSAVAGQWPWQVSI-------TYEGVHVCGGSLVSEQWVLSAAHCFPSEHHK-----E 94
            |:||..||.|.|.:....|||       .:...|:|||:|::.:.||:||||..:...|     .
  Fly    30 QSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRAS 94

Human    95 AYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFS------RYIRPI 153
            .:.|.||......:.....||.:..:....::..:..:.|:.:|.|...:..|      ..:.||
  Fly    95 EFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPI 159

Human   154 CLPAANASFPNGLHCTVTGWGHVAPSV---SLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPH 215
            .|  |....|.|..|.|.|||....|.   .|||      ..|..|..:||..:|.....|    
  Fly   160 QL--AGQITPPGKLCQVAGWGRTEQSSLSNILLT------ANVSTIRHQTCRMIYRSGLLP---- 212

Human   216 FVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASW 280
                .|:|||.::||.|:|||||||||  ..||  .|.|:||||..|.....||||.....|..|
  Fly   213 ----GMMCAGRLQGGTDSCQGDSGGPL--VHEG--RLVGVVSWGYGCAEPGLPGVYVDVEYYRQW 269

Human   281 IQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWL 340
            |:.:             ...|.|.|           |.||   .|.|.|.|.:.....||
  Fly   270 IEGR-------------SGAPHSRL-----------ATGL---FLLLLLPLLMRCSGSWL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 81/257 (32%)
Tryp_SPc 45..284 CDD:238113 82/259 (32%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 81/257 (32%)
Tryp_SPc 33..271 CDD:238113 81/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.