DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG33459

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:296 Identity:93/296 - (31%)
Similarity:128/296 - (43%) Gaps:67/296 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    12 LGAVAILLYLGLLRSGTGAEGAEAPCGVAP-QARITGGSSAVAGQWPWQVSITYEGVHVCGGSLV 75
            |..:|:||              |..||..| :.||.||..|.....||...:......:|||||:
  Fly    18 LYGLAVLL--------------EPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLI 68

Human    76 SEQWVLSAAHC-FPSEHHKEAYEVKLGAH----QLDSYS--EDAKVSTLKDIIPHPSYLQEGSQG 133
            :.::||:|||| .|:..:   ..|:||.:    |:||.:  ...:...:..|..||||....:. 
  Fly    69 TSEFVLTAAHCVMPTPKN---LTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAY- 129

Human   134 DIALLQLSRPITFSRYIRPICLPAANASFPNGLH-----------CTVTGWGHV-APSVSLLTPK 186
            |||||:|::.:.::..||||||     ..|...|           .|:||||.. ...||    :
  Fly   130 DIALLKLNQTVEYTVAIRPICL-----VLPENFHEWYWLVDSVEDFTLTGWGATKTEPVS----Q 185

Human   187 PLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCP-VEGLW 250
            .||...:..|.|.||:..|.        |.|....:|||  .....||.||||.||:.. |....
  Fly   186 VLQSANLTQIDRGTCHDRYG--------HSVDHTHICAG--SSKSFACVGDSGSPLAMKVVHNRR 240

Human   251 YL---TGIVSWGDACGARNRPG--VYTLASSYASWI 281
            |:   .||||    .|.:|..|  |:|...|:..||
  Fly   241 YIHAQVGIVS----RGPKNCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 83/261 (32%)
Tryp_SPc 45..284 CDD:238113 84/262 (32%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 83/261 (32%)
Tryp_SPc 38..272 CDD:238113 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.