DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG33462

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:113/282 - (40%) Gaps:54/282 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    34 EAPCGVAPQARITGGSSAVAGQWPWQVSI-TYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYE 97
            |..||: |........:|...|.||...: |.:|.| |.|:|::..:||:||||.|.:   ....
  Fly    26 EEDCGI-PHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDD---LLIT 85

Human    98 VKLGAHQLDSYSEDAKVSTLKDIIPHP------------SYLQEGSQ-GDIALLQLSRPITFSRY 149
            |:||     .|:...||.....:...|            .|.....| .||.:|:|.|.:.:..:
  Fly    86 VRLG-----EYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNH 145

Human   150 IRPICLPAANASFPNGLH----CTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAK 210
            |||||:.|:| .|...:.    .|.|.|...|.:.   |.|.|:.:.:....:|||:.:|..:..
  Fly   146 IRPICIFASN-RFQEPIDQLTWFTTTVWRETAANA---TSKVLRTMNIDRQPKETCSEIYGWNMT 206

Human   211 PEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWY-------LTGIVSWGDACGARNRP 268
            .|:        :|||...  ...|..|||.|   .:..:|:       ..||.|  ...|.....
  Fly   207 FEQ--------ICAGNTL--SQLCSTDSGAP---QIRKMWHNGSDRYVQLGIAS--RVKGQCQNS 256

Human   269 GVYTLASSYASWIQSKVTELQP 290
            |:.....|||.||:..|.:..|
  Fly   257 GILMDLLSYADWIKRVVRQYGP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 68/261 (26%)
Tryp_SPc 45..284 CDD:238113 70/263 (27%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 68/251 (27%)
Tryp_SPc 48..269 CDD:214473 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.