DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG30088

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:263 Identity:83/263 - (31%)
Similarity:126/263 - (47%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    37 CGVAPQA----RITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYE 97
            |||:.::    ||..|..|:....|:...:.|.....|||:::|.:::|:||||.     :...:
  Fly    33 CGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCM-----RPYLK 92

Human    98 VKLGAHQLDSYSEDAKVSTLK------DIIPHPSY--LQEGSQGDIALLQLSRPITFSRYIRPIC 154
            |:||.|.: :.:.|.:..:..      ||:....|  .......|||||:|||.|.|:.:|:|||
  Fly    93 VRLGEHDI-TRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPIC 156

Human   155 LPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQE 219
            |....|:.||.......|||...      |......|:..:::|.......::.:.|     :..
  Fly   157 LILNPAAAPNVHEFQAFGWGQTE------TNHSANVLQTTVLTRYDNRHCRSVLSMP-----ITI 210

Human   220 DMVCAGYVEGGKDACQGDSGGPLSCPV--EGLW-YL-TGIVSWG-DACGARNRPGVYTLASSYAS 279
            :.:|.|:  .|.|.|.|||||||...|  :|:| || .||||:| |.|   ..|||||...:|..
  Fly   211 NQLCVGF--QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKC---QSPGVYTYVPNYIR 270

Human   280 WIQ 282
            ||:
  Fly   271 WIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 78/249 (31%)
Tryp_SPc 45..284 CDD:238113 79/251 (31%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 78/249 (31%)
Tryp_SPc 45..273 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.