DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS8 and CG30087

DIOPT Version :9

Sequence 1:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:264 Identity:81/264 - (30%)
Similarity:127/264 - (48%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    37 CGVAPQA----RITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHC-FPSEHHKEAY 96
            |||..::    |:..|..||....|:.|.:|...:..||||:::.:::|:|||| ||:      .
  Fly    30 CGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCVFPN------L 88

Human    97 EVKLGAHQL--------DSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPI 153
            .::||.|.:        .:.|..::...:...|.|..|.......|||||:|:|.|.|:.:|:||
  Fly    89 RLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPI 153

Human   154 CLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQ 218
            |:....||.|:.......|||....:.   .|..||..|:.......|:..::.        ::.
  Fly   154 CILLNPASAPSVATYQTFGWGETKKNG---FPHLLQTAELRAYDAAYCSRSFHA--------YMN 207

Human   219 EDMVCAGYVEGGKDACQGDSGGPLSCPV--EGL--WYLTGIVSWGDA-CGARNRPGVYTLASSYA 278
            .:.:|||:.|  :|.|.|||||||...|  :|:  :...||||:|.. |   ..|||||...:|.
  Fly   208 GNQICAGHEE--RDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDC---QSPGVYTYVPNYI 267

Human   279 SWIQ 282
            :||:
  Fly   268 NWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 76/250 (30%)
Tryp_SPc 45..284 CDD:238113 77/252 (31%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 76/250 (30%)
Tryp_SPc 42..272 CDD:238113 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.