DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alx1 and Drgx

DIOPT Version :9

Sequence 1:NP_001038539.1 Gene:alx1 / 565176 ZFINID:ZDB-GENE-050419-191 Length:320 Species:Danio rerio
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:404 Identity:98/404 - (24%)
Similarity:132/404 - (32%) Gaps:202/404 - (50%)


- Green bases have known domain annotations that are detailed below.


Zfish   112 DSNVSSSKKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWR 176
            |......|:||:|||||..||||||..|.:||||||:.||.|||:..||||||||||||||||||
  Fly    44 DETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWR 108

Zfish   177 KRERY----------------------------------------------------GQIQQAKS 189
            |.||.                                                    ||::|..|
  Fly   109 KAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHS 173

Zfish   190 HFAATYDISMLP-------RTDSYSQISNNLWT-------------------------------- 215
            | :.::..|..|       .:|:...:|:|..|                                
  Fly   174 H-SHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGMHREREHTPL 237

Zfish   216 ------GPSA---------------------GSSVVSSCMIPRGSPPCVTSPY----PHS----- 244
                  |||:                     ||.:.:|......|.|..|:|:    |||     
  Fly   238 VGGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPTPTTPHAPQMPHSSAAAA 302

Zfish   245 -------------------------------------------PRAAEHGYVGFPNHQQNQF--- 263
                                                       .|:|.|..:..|.|...||   
  Fly   303 AAFGSHIFGNFGGGSNASDSNCGFRPVLSEQSAVAAAAAAAAAQRSANHPPLFLPPHLAAQFTHQ 367

Zfish   264 ----GVNHVSL-----------------NNFFADSLLASSANSHAAFETKPE-------FERRSS 300
                |:..||.                 ::..|...:..|::|.|:....|:       .:.||:
  Fly   368 PLFPGLKGVSPFQSLCSCCSLKPPPPPGSSVVAPLSIPVSSSSAASSPESPKSSGQGSVHDPRSN 432

Zfish   301 SIAVLRMKAKEHTA 314
            |:|.||.||:||:|
  Fly   433 SVAELRRKAQEHSA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alx1NP_001038539.1 Homeobox 123..176 CDD:278475 39/52 (75%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 180..320 51/336 (15%)
OAR 296..313 CDD:281777 9/16 (56%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 300..313 7/12 (58%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 39/51 (76%)
OAR 428..445 CDD:281777 9/16 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.