Sequence 1: | NP_001038539.1 | Gene: | alx1 / 565176 | ZFINID: | ZDB-GENE-050419-191 | Length: | 320 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097075.2 | Gene: | Drgx / 5740176 | FlyBaseID: | FBgn0085369 | Length: | 587 | Species: | Drosophila melanogaster |
Alignment Length: | 404 | Identity: | 98/404 - (24%) |
---|---|---|---|
Similarity: | 132/404 - (32%) | Gaps: | 202/404 - (50%) |
- Green bases have known domain annotations that are detailed below.
Zfish 112 DSNVSSSKKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWR 176
Zfish 177 KRERY----------------------------------------------------GQIQQAKS 189
Zfish 190 HFAATYDISMLP-------RTDSYSQISNNLWT-------------------------------- 215
Zfish 216 ------GPSA---------------------GSSVVSSCMIPRGSPPCVTSPY----PHS----- 244
Zfish 245 -------------------------------------------PRAAEHGYVGFPNHQQNQF--- 263
Zfish 264 ----GVNHVSL-----------------NNFFADSLLASSANSHAAFETKPE-------FERRSS 300
Zfish 301 SIAVLRMKAKEHTA 314 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
alx1 | NP_001038539.1 | Homeobox | 123..176 | CDD:278475 | 39/52 (75%) |
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 | 180..320 | 51/336 (15%) | |||
OAR | 296..313 | CDD:281777 | 9/16 (56%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 300..313 | 7/12 (58%) | |||
Drgx | NP_001097075.2 | Homeobox | 56..108 | CDD:278475 | 39/51 (76%) |
OAR | 428..445 | CDD:281777 | 9/16 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |