DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ5 and rpl3703

DIOPT Version :9

Sequence 1:NP_001153605.1 Gene:KCNQ5 / 56479 HGNCID:6299 Length:951 Species:Homo sapiens
Sequence 2:NP_001018221.1 Gene:rpl3703 / 3361407 PomBaseID:SPAPB17E12.05 Length:89 Species:Schizosaccharomyces pombe


Alignment Length:69 Identity:18/69 - (26%)
Similarity:25/69 - (36%) Gaps:17/69 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    67 TLGGGGGGLRES-------RRGK-----QGARMSLLGKPLSYTSSQSCRRNVKYRRV-----QNY 114
            |.|....|:|.:       |.||     |.:..:..|.|.:.|.|.:.....|.||.     .:|
pombe     2 TKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMSY 66

Human   115 LYNV 118
            |..|
pombe    67 LKKV 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQ5NP_001153605.1 Ion_trans 160..358 CDD:278921
Ion_trans_2 274..348 CDD:285168
Selectivity filter. /evidence=ECO:0000250 311..316
KCNQ_channel 472..659 CDD:281513
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 674..697
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 895..938
rpl3703NP_001018221.1 PTZ00073 1..81 CDD:240257 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.