powered by:
Protein Alignment KCNQ5 and rpl3703
DIOPT Version :9
Sequence 1: | NP_001153605.1 |
Gene: | KCNQ5 / 56479 |
HGNCID: | 6299 |
Length: | 951 |
Species: | Homo sapiens |
Sequence 2: | NP_001018221.1 |
Gene: | rpl3703 / 3361407 |
PomBaseID: | SPAPB17E12.05 |
Length: | 89 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 69 |
Identity: | 18/69 - (26%) |
Similarity: | 25/69 - (36%) |
Gaps: | 17/69 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 67 TLGGGGGGLRES-------RRGK-----QGARMSLLGKPLSYTSSQSCRRNVKYRRV-----QNY 114
|.|....|:|.: |.|| |.:..:..|.|.:.|.|.:.....|.||. .:|
pombe 2 TKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMSY 66
Human 115 LYNV 118
|..|
pombe 67 LKKV 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2126 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.