DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment batf and kay

DIOPT Version :9

Sequence 1:XP_005160917.1 Gene:batf / 564589 ZFINID:ZDB-GENE-041014-291 Length:124 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:141 Identity:37/141 - (26%)
Similarity:59/141 - (41%) Gaps:29/141 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish     4 GSDNNDTSYT-------KSPSPGNKQGSSDDMRKVMRREKNRIAAQKSRMRQTQKADSLHLESES 61
            ||.|.:||.|       :.|:........::.::.:|||:|:.||.:.|.|:..:.:.|..|.|.
  Fly   388 GSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQ 452

Zfish    62 LEKENAALRKEVKRLTEEAKYLSTVLSNHEPLC-------------------TGLSGASPELLYG 107
            |||...::|||::.||.....|..:|:.|...|                   .||..|...   |
  Fly   453 LEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSS---G 514

Zfish   108 AHHGAFHQHIS 118
            :...:.|.|.|
  Fly   515 SGASSHHNHNS 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
batfXP_005160917.1 bZIP_BATF 27..84 CDD:269849 19/56 (34%)
coiled coil 29..83 CDD:269849 19/53 (36%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 21/60 (35%)
coiled coil 421..480 CDD:269869 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.