DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Foxo1 and fd19B

DIOPT Version :10

Sequence 1:NP_062713.2 Gene:Foxo1 / 56458 MGIID:1890077 Length:652 Species:Mus musculus
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:159 Identity:46/159 - (28%)
Similarity:75/159 - (47%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse   151 SSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLS 215
            :::.||....:|:.||..||.||:|||||||.|.:|:..:.||::.:     .:.|:||||||||
  Fly    52 AAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTR-----KSVWQNSIRHNLS 111

Mouse   216 LHSKFIRVQN--EGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQ 278
            |:..|:||..  :..|:..:|.|:|..               .:....::.||..:     .:.|
  Fly   112 LNPFFVRVPRALDDPGRGHYWALDPYA---------------EDLSIGETTGRLRR-----SNWQ 156

Mouse   279 EGPGDSP---GSQFSKWPASPGSHSNDDF 304
            :..|..|   |..:.:.|.....|.|..:
  Fly   157 QNTGARPKVTGHPYQRMPYYGHGHGNGPY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Foxo1NP_062713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..154 0/2 (0%)
FH_FOXO1 148..246 CDD:410834 37/96 (39%)
DNA-binding. /evidence=ECO:0000250|UniProtKB:Q12778 208..215 6/6 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..342 12/77 (16%)
DNA-binding. /evidence=ECO:0000250|UniProtKB:Q12778 231..234 0/2 (0%)
Nuclear localization signal. /evidence=ECO:0000250 248..250 0/1 (0%)
Sufficient for interaction with NLK. /evidence=ECO:0000269|PubMed:20061393 280..562 6/28 (21%)
Required for interaction with RUNX2. /evidence=ECO:0000269|PubMed:21471200 360..456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..410
FOXO_KIX_bdg 420..501 CDD:465228
Required for interaction with SIRT1. /evidence=ECO:0000269|PubMed:15220471 459..463
FOXO-TAD 594..630 CDD:435506
fd19BNP_608369.1 Forkhead 58..140 CDD:459732 35/101 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.