DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:ch211-153j24.3 and kay

DIOPT Version :9

Sequence 1:XP_692833.6 Gene:si:ch211-153j24.3 / 564403 ZFINID:ZDB-GENE-041014-38 Length:329 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:265 Identity:71/265 - (26%)
Similarity:119/265 - (44%) Gaps:20/265 - (7%)


- Green bases have known domain annotations that are detailed below.


Zfish    55 STDISSVSPCRQQKTQSSSHSTDAKAARKTFTGRRKGAKDQLSPEEEERKRIRRERNKLAAAKCR 119
            |..:::||..|...:..||::..:....:...|||......::||||:::.:||||||.|||:||
  Fly   372 SNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCR 436

Zfish   120 NRRRDLTNSLQAETDGLEEDKAALQSEIASLLKEKERLELILSAHKPHCK------LTEETENEE 178
            .||.|.||.|..|.:.||:...:::.||..|...|.:||.:|:.|:..|:      |:..|.|..
  Fly   437 KRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGL 501

Zfish   179 PAPAQEEKTQAASVPEQVPASPPQADPTSAAIFGDSDVLLCSSAELGAAEVEPYIDMRDVCM--- 240
            .|||......::........:....|.::..|.|....|..:.......:::|..::..:.|   
  Fly   502 IAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIK 566

Zfish   241 -EDISSVIDSGDDMD---------LLVPDIDLSSSLGLSEWETLYMSMGGGLE-PLSSPTCSPST 294
             |.:...||||..:|         :.:|.:.....:.||...|...:..|.|: |::|.......
  Fly   567 DEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTILTPTGASSGSLQTPITSTAPGGFG 631

Zfish   295 DAVPV 299
            .|.||
  Fly   632 SAFPV 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:ch211-153j24.3XP_692833.6 bZIP_Fos 111..164 CDD:269869 23/52 (44%)
coiled coil 111..163 CDD:269869 23/51 (45%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 27/60 (45%)
coiled coil 421..480 CDD:269869 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10618
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002314
OrthoInspector 1 1.000 - - otm24837
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.