DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRSS1 and alphaTry

DIOPT Version :9

Sequence 1:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:261 Identity:100/261 - (38%)
Similarity:141/261 - (54%) Gaps:27/261 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   229 LLILTFVAAALAAPFDD------DDKIVGGYNCEENSVPYQVSL-NSGYHFCGGSLINEQWVVSA 286
            :::|:.|..||.....:      |.:||||.....:|.|:|:|| .||.|.||||:.:...:|:|
  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69

Human   287 GHCYK----SRIQVRLGE---HNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVI 344
            .||.:    |.:|||.|.   .:..|:.....|.|      |..|:..|:.|||.:|:|||....
  Fly    70 AHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKN------HEGYNANTMVNDIAVIRLSSSLSF 128

Human   345 NARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEAS---YPGKITS 406
            ::.:..|||.|..||.|....:||||..:|..:..|.:||.::..::||::|.:|   |..:|.:
  Fly   129 SSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRN 193

Human   407 NMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAAN 471
            .|.|..  ..|||:||||||||:|..|.|.||||||.|||..|.||||..|.....|:.:|  ||
  Fly   194 TMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST--AN 254

Human   472 S 472
            |
  Fly   255 S 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 90/226 (40%)
Tryp_SPc 249..467 CDD:238113 91/228 (40%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 90/226 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.