DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrad and Rgk1

DIOPT Version :9

Sequence 1:NP_062636.2 Gene:Rrad / 56437 MGIID:1930943 Length:307 Species:Mus musculus
Sequence 2:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster


Alignment Length:384 Identity:112/384 - (29%)
Similarity:156/384 - (40%) Gaps:106/384 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 GSRGAGR--------ERDRRRGSTPWGPAPPLHR-RSMPV---------DERDLQAALAPGSLAT 57
            |||.:||        :|.|.......|.....:| |...:         |....:.:.:..|:|:
  Fly  1015 GSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVAS 1079

Mouse    58 TAAGTR--TQGQRLDWPEGSS------DSLSSGGSGSEEGVYKVLLLGAPGVGKSALARIFGGIE 114
            :.:.|.  |..|:|..|...|      .|..|..|....|.|:||:||.|.||||:|...|...|
  Fly  1080 SNSSTEHLTTQQQLSAPASVSARTSLASSRESSTSNPGNGPYRVLMLGGPAVGKSSLVSQFMTSE 1144

Mouse   115 DGPEAEAAGHTYDRSI-----------TVDGEEASLLVYDIWEQDGGCWLPGHCMAMGD--AYVI 166
                   ..|.||.||           .:.|||:.|:..|....:   ..|..|:...|  .|.:
  Fly  1145 -------YLHAYDTSIDDESGEKAVSVLLSGEESELIFIDHGYTE---MTPDECLTNYDPHGYCV 1199

Mouse   167 VYSITDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIET 231
            :||..|:.||..|.::...|...:......:|||.||:||.|||.|:.:||:|.|..:|||||||
  Fly  1200 IYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIET 1264

Mouse   232 SAALHHNVQALFEGVVRQIRLR-------RD---------------------------------- 255
            |..::|||..|..|::.||||:       ||                                  
  Fly  1265 SVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGE 1329

Mouse   256 -------SKEDNARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL 307
                   |.:.:.|:..|:|...||  |.|..|||:..|:|       |||||.:|.||
  Fly  1330 AVATPPGSAQSSPRKYRGSRTSTSL--KVKGLLGRVWTRDS-------KSKSCENLHVL 1379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RradNP_062636.2 RGK 91..307 CDD:206715 87/276 (32%)
Calmodulin-binding. /evidence=ECO:0000250 277..296 6/18 (33%)
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 87/276 (32%)
small_GTPase 1121..1286 CDD:197466 65/174 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2445
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8675
orthoMCL 1 0.900 - - OOG6_109169
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5084
SonicParanoid 1 1.000 - - X743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.