DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fosl1a and kay

DIOPT Version :9

Sequence 1:XP_009289400.1 Gene:fosl1a / 564241 ZFINID:ZDB-GENE-061207-7 Length:347 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:435 Identity:102/435 - (23%)
Similarity:153/435 - (35%) Gaps:158/435 - (36%)


- Green bases have known domain annotations that are detailed below.


Zfish    25 SSSASVATTTGTTQQQQQKYSVAGSGQF-VPSL--NAI----------TSNQSLQWMLQPSIGTP 76
            :::.::..|.|......|...|||...| ||.:  |||          .|:..||.....|:|..
  Fly   255 TTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIPTGVSSLPLQQTFDLSLGQG 319

Zfish    77 GPSRALRSSYPLPPGIPATMNPPQ----PSQSH---------------------------LSRPG 110
            ..|....:||.     ...||..|    .|.:|                           |:...
  Fly   320 SESEDSNASYN-----DTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVS 379

Zfish   111 VIRAAAAIGSTT-------------RR--NDEYLSPEELERRRIRRERNKMAAAKCRNRRRELTD 160
            ..|.:|::||:.             ||  ....::|||.::|.:||||||.|||:||.||.:.|:
  Fly   380 SSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTN 444

Zfish   161 TLQNETDQLEDEKSRLQKEIADLQKEKEKLELVFEAHRPICKVQESE------------------ 207
            .|..|.:|||.....::|||..|...|.:||.:...||..|:...|:                  
  Fly   445 ELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLS 509

Zfish   208 --------------SDSDSSN--------------------------DIPS-LSGIKIEPVDP-- 229
                          :.:||||                          :|.| |..||.||:|.  
  Fly   510 AGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAI 574

Zfish   230 ------DLPGPSRETKHYAKINKPKPKITIPPPPS------ASSITGIPLESESLHTPVLISTPS 282
                  |..||           .|..:||:||..:      ::.:|.....|.||.||:..:.| 
  Fly   575 DSGSSLDQDGP-----------PPSKRITLPPMSTMPHVHLSTILTPTGASSGSLQTPITSTAP- 627

Zfish   283 LTPFTASLVFSYPSTSLDTSSQALNLVTSHPSSQNPQPCAVAHRR 327
                 .....::|.||..:|...:|.:.::.:|    |...||.:
  Fly   628 -----GGFGSAFPVTSNGSSINNINSIGNNMNS----PTLNAHNK 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fosl1aXP_009289400.1 bZIP_Fos 144..197 CDD:269869 22/52 (42%)
coiled coil 144..196 CDD:269869 22/51 (43%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 27/60 (45%)
coiled coil 421..480 CDD:269869 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10618
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002314
OrthoInspector 1 1.000 - - otm24837
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.