DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRPH and LamC

DIOPT Version :9

Sequence 1:XP_005269082.1 Gene:PRPH / 5630 HGNCID:9461 Length:471 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:486 Identity:133/486 - (27%)
Similarity:231/486 - (47%) Gaps:93/486 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    38 SRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQELQ 102
            ||.|:|..:|.||.||.|...|..||..                          .:|..||:|||
  Fly    13 SRASTSTPVGGASTSSRVGATSPTSPTR--------------------------TSRQQEKEELQ 51

Human   103 ELNDRFANFIEKVRFLEQQNAALRGELSQAR---GQEPARADQLCQQELRELRRELELLGRERDR 164
            .||||.|.:|:::|.||.:|:.|..||:.|:   .:|.:....:.::||...|:.|:...:|:.:
  Fly    52 HLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAK 116

Human   165 VQVERDGLAEDLAALKQRLEEETRKREDAEHNLVLF----------------------------- 200
            ::::...|.|:...||.||:::|::...||:|..|:                             
  Fly   117 LEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELA 181

Human   201 -------------RKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQVSVESQQVQQVE 252
                         ||.::..||:|::||.:.:||.:|:.|..::|.:||.:.:   ..:|::..|
  Fly   182 LENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETR---SRRQIEISE 243

Human   253 VEATV----KPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANRNHEALRQAKQEMN 313
            ::..:    :.:|..:|:::|.|||.....|.:|.|..|.::..:|..||||..:....|.:|:.
  Fly   244 IDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVR 308

Human   314 ESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAARLEEELRQLKEEMARHLRE 378
            ..|.:|..|..::..|..||..|..::||||.....|...:....|.||.||:::::|||..|:|
  Fly   309 LMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQE 373

Human   379 YQELLNVKMALDIEIATYRKLLEGEESRISV--PVHSFASLNIKTTVPEVEPPQDSHSRKTVLIK 441
            ||.|:::|::||:|||.|.|||.|||.|:::  |........|.:....:.....|.|.:.    
  Fly   374 YQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSRSGRV---- 434

Human   442 TIETRNGEQVVT------ESQKEQRSELDKS 466
               |.:|.:..|      .:.|.:|:.:|:|
  Fly   435 ---TPSGRRSATPGISGSSAVKRRRTVIDES 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRPHXP_005269082.1 Filament_head 13..95 CDD:282575 13/56 (23%)
Filament 96..406 CDD:278467 107/358 (30%)
BAR <199..373 CDD:299863 52/219 (24%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 107/358 (30%)
ATP-synt_B <67..>142 CDD:304375 20/74 (27%)
MreC <178..>224 CDD:302802 11/45 (24%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.