DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stx16 and Syx7

DIOPT Version :9

Sequence 1:XP_021332963.1 Gene:stx16 / 562857 ZFINID:ZDB-GENE-060810-113 Length:324 Species:Danio rerio
Sequence 2:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster


Alignment Length:270 Identity:68/270 - (25%)
Similarity:123/270 - (45%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


Zfish    81 GVDEIQYE-----ITRIRQKMKELASLHDKHMNR-PTLDDSSEEEHAIEITTQEITQMFHRCQRA 139
            |:.||.::     |....||:::..|...:.:|: .|..||.|       ..:::.|:.....:.
  Fly    17 GLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPE-------LKKQLHQIMTYTNQL 74

Zfish   140 VTGLQTQ--------SYHCTEQENRLLTNVVSSLA--QSLQELSLNFRHTQSGYLKRMKN----- 189
            ||....|        ..|...|.:||:....::|.  ||:|..:.:...|.   |::.:.     
  Fly    75 VTDTNNQINEVDKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTA---LRQARGDSYNI 136

Zfish   190 -REERSKHFFDSGPLVEEDEDIALYDRGFTDDQLVLVQQNTVM--------VEEREREIRQIVQS 245
             |...|.....|.....:.::.:.::..|.:.:....|..|.|        :||:|:.||::..:
  Fly   137 ARPPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALEEQEQVIRELENN 201

Zfish   246 ISDLNEIFRDLAGMVVEQGTVLDRIDFNVEQSCVKTEEGLQQLQKAEQYQKKNRKMLVIL--ILF 308
            |..:|||::.|..:|.|||..:|.|:..|||:.:...:|.:.|:||..|:.|.||..:||  ||.
  Fly   202 IVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILS 266

Zfish   309 VIVVVLILIL 318
            .:::.:||||
  Fly   267 AVLLAIILIL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stx16XP_021332963.1 SynN 73..300 CDD:330835 58/248 (23%)
SNARE_syntaxin16 232..290 CDD:277198 21/57 (37%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 22/105 (21%)
COG5325 <97..276 CDD:227635 48/181 (27%)
SNARE 188..247 CDD:304603 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.